Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MOG protein

This Human MOG protein spans the amino acid sequence from region 30-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTN6, BTNL11, MGC26137, MOG alpha 5, MOG alpha 6, MOG AluA, MOG AluB, MOG, MOG Ig AluB, MOG_HUMAN, MOGIG2, Myelin oligodendrocyte glycoprotein, Myelin-oligodendrocyte glycoprotein, NRCLP7

UniProt

Q16653

Expression Region

30-154aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI30, Human (HEK293, His)
HY-P75820-01 5 µg

IFI30, Human (HEK293, His)

Sign In for Pricing
View Details
IFI30, Human (HEK293, His)
HY-P75820-02 10 µg

IFI30, Human (HEK293, His)

Sign In for Pricing
View Details
IFI30, Human (HEK293, His)
HY-P75820-03 50 µg

IFI30, Human (HEK293, His)

Sign In for Pricing
View Details
IFI30, Human (HEK293, His)
HY-P75820-04 100 µg

IFI30, Human (HEK293, His)

Sign In for Pricing
View Details
BS-C-1 Cells
T1200 1x106 cells / 1.0 mL

BS-C-1 Cells

Sign In for Pricing
View Details
N4-Acetyl-CTP 100mM Sodium Solution
CTPAC001-1 1 mL

N4-Acetyl-CTP 100mM Sodium Solution

Sign In for Pricing
View Details