Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI30, Human (HEK293, His)

IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IFI30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifi30-protein-human-hek293-his.html

Purity

95.0

Smiles

SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSS

Molecular Formula

10437 (Gene_ID) P13284 (S27-K243) (Accession)

Molecular Weight

31-34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF806076 100 µg

AKT1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS621203 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
KPNA6 Rabbit Polyclonal Antibody
TA377890 100 µL

KPNA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629443 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF647 conjugate, 0.1mg/mL
BNC471958-100 1x 100 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1 NTD (L18F, D80A, D215G, ΔLAL242-244, R246I) (His Tag)
PKSV030362 100 µg

Recombinant SARS-CoV-2 Spike S1 NTD (L18F, D80A, D215G, ΔLAL242-244, R246I) (His Tag)

Sign In for Pricing
View Details