Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI30, Human (HEK293, His)

IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IFI30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifi30-protein-human-hek293-his.html

Purity

95.0

Smiles

SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSS

Molecular Formula

10437 (Gene_ID) P13284 (S27-K243) (Accession)

Molecular Weight

31-34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXTRAClean Urine Cell-Free Circulating RNA Purification Midi Kit
73910 20 Preparations

EXTRAClean Urine Cell-Free Circulating RNA Purification Midi Kit

Sign In for Pricing
View Details
Cenpp Mouse Gene Knockout Kit (CRISPR)
KN503137 1 Kit

Cenpp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MANEL (MANEAL) (NM_001113482) Human Over-expression Lysate
LY426415 100 µg

MANEL (MANEAL) (NM_001113482) Human Over-expression Lysate

Sign In for Pricing
View Details
Natriuretic Peptide Receptor A (NPR1) (NM_000906) Human Over-expression Lysate
LY424461 100 µg

Natriuretic Peptide Receptor A (NPR1) (NM_000906) Human Over-expression Lysate

Sign In for Pricing
View Details
Medium Water Purification System BDPS-401
BDPS-401 1 Unit

Medium Water Purification System BDPS-401

Sign In for Pricing
View Details
IGHMBP2 Antibody
KC-1282-01 50 μL

IGHMBP2 Antibody

Sign In for Pricing
View Details