Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI30, Human (HEK293, His)

IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IFI30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifi30-protein-human-hek293-his.html

Purity

95.0

Smiles

SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSS

Molecular Formula

10437 (Gene_ID) P13284 (S27-K243) (Accession)

Molecular Weight

31-34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrated OR lamp BOPL-307
BOPL-307 1 Unit

Integrated OR lamp BOPL-307

Sign In for Pricing
View Details
CD8 Mouse Monoclonal Antibody [Clone ID: EP72]
AM08138FC-N 500 µg

CD8 Mouse Monoclonal Antibody [Clone ID: EP72]

Sign In for Pricing
View Details
TRAF2 (NM_021138) Human Over-expression Lysate
LY402843 100 µg

TRAF2 (NM_021138) Human Over-expression Lysate

Sign In for Pricing
View Details
Accuris qMAX Probe, No Rox qPCR Mix, sample, 20 reactions
PR2001-N-S 1 Each

Accuris qMAX Probe, No Rox qPCR Mix, sample, 20 reactions

Sign In for Pricing
View Details
Recombinant TOE1 Antibody
RC-16543-01 50 μL

Recombinant TOE1 Antibody

Sign In for Pricing
View Details
Recombinant TOE1 Antibody
RC-16543-02 100 µL

Recombinant TOE1 Antibody

Sign In for Pricing
View Details