Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI30, Human (HEK293, His)

IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IFI30 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifi30-protein-human-hek293-his.html

Purity

95.0

Smiles

SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSS

Molecular Formula

10437 (Gene_ID) P13284 (S27-K243) (Accession)

Molecular Weight

31-34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Siglec-7/CD328, C-His (ECD)
HA210942-01 20 µg

Human Siglec-7/CD328, C-His (ECD)

Sign In for Pricing
View Details
Human Siglec-7/CD328, C-His (ECD)
HA210942-02 50 µg

Human Siglec-7/CD328, C-His (ECD)

Sign In for Pricing
View Details
Human Siglec-7/CD328, C-His (ECD)
HA210942-03 100 µg

Human Siglec-7/CD328, C-His (ECD)

Sign In for Pricing
View Details
Human CLEC4C activation kit by CRISPRa
GA116208 1 Kit

Human CLEC4C activation kit by CRISPRa

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[5D7]
E-AB-F1371D-01 20 Tests

PE Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
PE Anti-Human CD5 Antibody[5D7]
E-AB-F1371D-02 100 Tests

PE Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details