Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP4 Rabbit Polyclonal Antibody (HRP)

CASP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TX, Mih1, ICH-2, Mih1/TX, ICEREL-II, ICE (rel) II

UniProt

P49662

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CASP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001216

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corticotropin Releasing Factor, human, rat
VAC-00709-01 1 mg

Corticotropin Releasing Factor, human, rat

Sign In for Pricing
View Details
Corticotropin Releasing Factor, human, rat
VAC-00709-02 5 mg

Corticotropin Releasing Factor, human, rat

Sign In for Pricing
View Details
Corticotropin Releasing Factor, human, rat
VAC-00709-03 10 mg

Corticotropin Releasing Factor, human, rat

Sign In for Pricing
View Details
WSB2 Antibody Blocking peptide
orb1447442 500 µg

WSB2 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse Monoclonal FITC Antibody (SPM395) [Alexa Fluor 350]
NBP3-08492AF350 100 µL

Mouse Monoclonal FITC Antibody (SPM395) [Alexa Fluor 350]

Sign In for Pricing
View Details
C19orf38 AAV Vector (Human) (CMV)
14064101 1 µg

C19orf38 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details