Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, human, rat

Product Specifications

Synonyms

Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser- Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2; H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Molecular Formula

C208H344N60O63S2

Molecular Weight

4,757.44 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE2 Antibody, FITC conjugated
CSB-PA896746LC01HU-01 50 µg

BACE2 Antibody, FITC conjugated

Sign In for Pricing
View Details
BACE2 Antibody, FITC conjugated
CSB-PA896746LC01HU-02 100 µg

BACE2 Antibody, FITC conjugated

Sign In for Pricing
View Details
1-Hydroxy-1,2-benziodoxol-3 (1H) -one
OR90055-01 250 mg

1-Hydroxy-1,2-benziodoxol-3 (1H) -one

Sign In for Pricing
View Details
1-Hydroxy-1,2-benziodoxol-3 (1H) -one
OR90055-02 5 g

1-Hydroxy-1,2-benziodoxol-3 (1H) -one

Sign In for Pricing
View Details
1-Hydroxy-1,2-benziodoxol-3 (1H) -one
OR90055-03 25 g

1-Hydroxy-1,2-benziodoxol-3 (1H) -one

Sign In for Pricing
View Details
1-Hydroxy-1,2-benziodoxol-3 (1H) -one
OR90055-04 100 g

1-Hydroxy-1,2-benziodoxol-3 (1H) -one

Sign In for Pricing
View Details