Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, human, rat

Product Specifications

Synonyms

Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser- Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2; H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Molecular Formula

C208H344N60O63S2

Molecular Weight

4,757.44 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish RBPMS2a/b Antibody Picoband®
AZQ6DH13 100 µg/Vial

Anti-Zebrafish RBPMS2a/b Antibody Picoband®

Sign In for Pricing
View Details
STFR M020-450x150-PE-CRD/1 AC Signs
820821 Card of 1 Pictogram(s)

STFR M020-450x150-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
Furano (2'',3'',7,6) -4'-hydroxyflavanone
TN4086 5 mg

Furano (2'',3'',7,6) -4'-hydroxyflavanone

Sign In for Pricing
View Details
Genesig® Advanced kit for G.intestinalis_A-F
Z-Path-G.intestinalis_A-F 150 Tests

Genesig® Advanced kit for G.intestinalis_A-F

Sign In for Pricing
View Details
BZW2 Adenovirus (Human)
13596051 1.0 mL

BZW2 Adenovirus (Human)

Sign In for Pricing
View Details
Rat Ubqln2 Pre-designed siRNA Set A
SI215551A 1 Each

Rat Ubqln2 Pre-designed siRNA Set A

Sign In for Pricing
View Details