Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, human, rat

Product Specifications

Synonyms

Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser- Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2; H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Molecular Formula

C208H344N60O63S2

Molecular Weight

4,757.44 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf73 3'UTR Luciferase Stable Cell Line
TU002214 1.0 mL

C2orf73 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Charged multivesicular body protein 4a (CHMP4A) ELISA Kit
GTR10333716 96 Well

Rabbit Charged multivesicular body protein 4a (CHMP4A) ELISA Kit

Sign In for Pricing
View Details
APC Anti-Human CD206 Antibody (15-2)
APC-30081-01 20 Tests

APC Anti-Human CD206 Antibody (15-2)

Sign In for Pricing
View Details
APC Anti-Human CD206 Antibody (15-2)
APC-30081-02 100 Tests

APC Anti-Human CD206 Antibody (15-2)

Sign In for Pricing
View Details
ALDH3A2 siRNA (Human)
orb1868099-01 15 nmol

ALDH3A2 siRNA (Human)

Sign In for Pricing
View Details
ALDH3A2 siRNA (Human)
orb1868099-02 30 nmol

ALDH3A2 siRNA (Human)

Sign In for Pricing
View Details