Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRM1 Rabbit Polyclonal Antibody (FITC)

ADRM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARM1, ARM-1, GP110, PSMD16

UniProt

Q16186

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADRM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_783163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALCOCO1 Double Nickase Plasmid (m)
sc-426594-NIC 20 µg

CALCOCO1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated
orb3005829-01 20 µg

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated
orb3005829-02 100 µg

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

Sign In for Pricing
View Details
Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated
orb3005829-03 1 mg

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

Sign In for Pricing
View Details
CABC1 antibody
70R-51046 100 µL

CABC1 antibody

Sign In for Pricing
View Details
ANGPTL7 Rabbit Polyclonal Antibody (HRP)
orb2112881 100 µL

ANGPTL7 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details