Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Rabbit Polyclonal Antibody (HRP)

ANGPTL7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AngX, CDT6, dJ647M16.1

UniProt

O43827

Immunogen

The immunogen for Anti-ANGPTL7 antibody is: synthetic peptide directed towards the N-terminal region of Human ANGL7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDD

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066969.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Uridine-Cytidine Kinase 2 (UCK2) ELISA Kit
MBS9356695 Inquire

Fish Uridine-Cytidine Kinase 2 (UCK2) ELISA Kit

Sign In for Pricing
View Details
P53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53, TRP53, Tumor Protein p53, Tumor Suppressor p53) (AP) discontinued
172135-AF-AP 100 µL

P53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53, TRP53, Tumor Protein p53, Tumor Suppressor p53) (AP) discontinued

Sign In for Pricing
View Details
CTGF (Connective Tissue Growth Factor, CCN2, Hypertrophic Chondrocyte-specific Gene Product 24, Hcs24, Insulin-like Growth Factor-Binding Protein 8, IGFBP8, MGC102839, NOV2) (Biotin)
C7978-25G 50 µg

CTGF (Connective Tissue Growth Factor, CCN2, Hypertrophic Chondrocyte-specific Gene Product 24, Hcs24, Insulin-like Growth Factor-Binding Protein 8, IGFBP8, MGC102839, NOV2) (Biotin)

Sign In for Pricing
View Details
Phospho-HER3/ErbB3  (Tyr1197)  Antibody
ABF3607 100 µg

Phospho-HER3/ErbB3 (Tyr1197) Antibody

Sign In for Pricing
View Details
5-Cyanothiophene-2-sulfonyl chloride
DXC59897-01 50 mg

5-Cyanothiophene-2-sulfonyl chloride

Sign In for Pricing
View Details
5-Cyanothiophene-2-sulfonyl chloride
DXC59897-02 0.5 g

5-Cyanothiophene-2-sulfonyl chloride

Sign In for Pricing
View Details