Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

This Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse St8sia3 shRNA (UAS) - Lentiviral mouse St8sia3 shRNA (UAS) plasmid
GTR15186175 1 Vial

Lentiviral mouse St8sia3 shRNA (UAS) - Lentiviral mouse St8sia3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride
OR1002167-01 100 mg

(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride

Sign In for Pricing
View Details
(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride
OR1002167-02 250 mg

(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride

Sign In for Pricing
View Details
(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride
OR1002167-03 500 mg

(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride

Sign In for Pricing
View Details
(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride
OR1002167-04 1 g

(1S,4R) -2-Azabicyclo[2.2.1]heptane hydrochloride

Sign In for Pricing
View Details
GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC)
MBS6302942-01 0.2 mL

GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC)

Sign In for Pricing
View Details