Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

This Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCN Antibody, FITC conjugated
CSB-PA10289C0Rb-01 50 µg

DCN Antibody, FITC conjugated

Sign In for Pricing
View Details
DCN Antibody, FITC conjugated
CSB-PA10289C0Rb-02 100 µg

DCN Antibody, FITC conjugated

Sign In for Pricing
View Details
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B9]
TA809373BM 100 µL

Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B9]

Sign In for Pricing
View Details
Osteocalcin (Bone-Gla-Protein, BGP) (AP) discontinued
O8060-17-AP 100 µL

Osteocalcin (Bone-Gla-Protein, BGP) (AP) discontinued

Sign In for Pricing
View Details
APOL2 Protein (N-His, Human)
P500596 100 µg

APOL2 Protein (N-His, Human)

Sign In for Pricing
View Details
Recombinant Immunoglobulin D (IgD)
TRV-0039405-01 10 µg

Recombinant Immunoglobulin D (IgD)

Sign In for Pricing
View Details