Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

This Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elsulfavirine
TRC-E976750-100MG 100 mg

Elsulfavirine

Sign In for Pricing
View Details
Mouse Monoclonal ORC1 Antibody (7F6/1) [HRP]
NBP3-08793H 100 µL

Mouse Monoclonal ORC1 Antibody (7F6/1) [HRP]

Sign In for Pricing
View Details
RPS12P26 sgRNA CRISPR Lentivector (Human) (Target 2)
K2026903 1.0 µg DNA

RPS12P26 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
EKU03867 96 Tests

Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details
L-trans-4-Fluoro-5-pyrrolidone-2-carboxylic acid
PC3159 1 Each

L-trans-4-Fluoro-5-pyrrolidone-2-carboxylic acid

Sign In for Pricing
View Details
HES1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H8]
TA503958BM 100 µL

HES1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H8]

Sign In for Pricing
View Details