Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAS6 Rabbit Polyclonal Antibody (HRP)

GAS6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AXSF, AXLLG

UniProt

Q14393

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Human GAS6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVV

Field of Research

Cancer Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)
PKSH031964-01 100 µg

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)
PKSH031964-02 1 mg

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF488A conjugate, 0.1mg/mL
BNC880631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNNC1 Polyclonal Antibody
E-AB-18400-01 20 µL

TNNC1 Polyclonal Antibody

Sign In for Pricing
View Details
TNNC1 Polyclonal Antibody
E-AB-18400-02 60 µL

TNNC1 Polyclonal Antibody

Sign In for Pricing
View Details
TNNC1 Polyclonal Antibody
E-AB-18400-03 120 µL

TNNC1 Polyclonal Antibody

Sign In for Pricing
View Details