Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

Q2YWT8

Expression Region

1-159

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL IIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid receptor/NF-κB modulator-1
T209710-01 10 mg

Glucocorticoid receptor/NF-κB modulator-1

Sign In for Pricing
View Details
Glucocorticoid receptor/NF-κB modulator-1
T209710-02 50 mg

Glucocorticoid receptor/NF-κB modulator-1

Sign In for Pricing
View Details
Rat Kallikrein 9 (KLK9) ELISA Kit
YP-W37732-01 48 Tests

Rat Kallikrein 9 (KLK9) ELISA Kit

Sign In for Pricing
View Details
Rat Kallikrein 9 (KLK9) ELISA Kit
YP-W37732-02 96 Tests

Rat Kallikrein 9 (KLK9) ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri rplF Protein (aa 1-180) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9730-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri rplF Protein (aa 1-180) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
Apolipoprotein E3 (R251) Human, Recombinant
orb2719836 1 mg

Apolipoprotein E3 (R251) Human, Recombinant

Sign In for Pricing
View Details