Apolipoprotein E3 (R251) Human, Recombinant
Apolipoprotein E3 (R251) (1.0 mg) Human, Recombinant
Product Specifications
Source
Protein expressed in Escherichia coli.
Field of Research
Metabolism Research
Purity
>95% by Chromatography and SDS-PAGE
Form
Lyophilized 1 mg/vial
Solubility
ApoE is soluble in PBS.
Molecular Weight
34268.74 Da
Storage Conditions
Room temperature, avoid light exposure.
Notes
For research use only.
AA Sequence
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIGLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1416490-01 0.02 mg (E-Coli)
Recombinant Burkholderia mallei Adenylate kinase (adk)
Sign In for Pricing
View Details MBS1416490-02 0.1 mg (E-Coli)
Recombinant Burkholderia mallei Adenylate kinase (adk)
Sign In for Pricing
View Details MBS1416490-03 0.02 mg (Yeast)
Recombinant Burkholderia mallei Adenylate kinase (adk)
Sign In for Pricing
View Details MBS1416490-04 0.1 mg (Yeast)
Recombinant Burkholderia mallei Adenylate kinase (adk)
Sign In for Pricing
View Details MBS1416490-05 0.02 mg (Baculovirus)
Recombinant Burkholderia mallei Adenylate kinase (adk)
Sign In for Pricing
View Details MBS1416490-06 0.02 mg (Mammalian-Cell)
Recombinant Burkholderia mallei Adenylate kinase (adk)
Sign In for Pricing
View Details