Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF149 Peptide - C-terminal region

RNF149 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAPTP2

UniProt

Q8NC42

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF149 Rabbit Polyclonal Antibody (orb578841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775918

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC100128108 activation kit by CRISPRa
GA119075 1 Kit

Human LOC100128108 activation kit by CRISPRa

Sign In for Pricing
View Details
IL17F Mouse
OM296462-01 25 µg

IL17F Mouse

Sign In for Pricing
View Details
IL17F Mouse
OM296462-02 5 µg

IL17F Mouse

Sign In for Pricing
View Details
IL17F Mouse
OM296462-03 1 mg

IL17F Mouse

Sign In for Pricing
View Details
PRPK (TP53RK) (NM_033550) Human Over-expression Lysate
LY403262 100 µg

PRPK (TP53RK) (NM_033550) Human Over-expression Lysate

Sign In for Pricing
View Details
B7 H6 (NCR3LG1) Human Gene Knockout Kit (CRISPR)
KN232774BN 1 Kit

B7 H6 (NCR3LG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details