IL17F Mouse
IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.
Product Specifications
Swiss Prot
Q7TNI7
Source
Escherichia Coli.
Buffer
IL17F was lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043140-100 1x 100 µL
Replication Protein A2 (RPA2) (RPA2/3140R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
