IL17F Mouse
IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.
Product Specifications
Swiss Prot
Q7TNI7
Source
Escherichia Coli.
Buffer
IL17F was lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6339434-01 0.1 mL
QPCTL, CT (QPCTL, Glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase, isoQC) (MaxLight 650)
Ask
View Details 
MBS6339434-02 5x 0.1 mL
QPCTL, CT (QPCTL, Glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase, isoQC) (MaxLight 650)
Ask
View Details 