IL17F Mouse
IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.
Product Specifications
Swiss Prot
Q7TNI7
Source
Escherichia Coli.
Buffer
IL17F was lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
11304-AAT 200 Tests
Amplite® Fluorimetric Xanthine Oxidase Assay Kit *Red Fluorescence*
Sign In for Pricing
View Details 
E-UNEL-R0066-01 5x 96 Tests
Uncoated Rat MMP-8 (Matrix Metalloproteinase 8) ELISA Kit
Sign In for Pricing
View Details E-UNEL-R0066-02 15x 96 Tests
Uncoated Rat MMP-8 (Matrix Metalloproteinase 8) ELISA Kit
Sign In for Pricing
View Details ![Elab Fluor® Violet 450 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]](https://cdn.genprice.uk/products/763/68dd149f061270361e7d0601/imageurl/an00429q.webp)
AN00429Q-01 50 Tests
Elab Fluor® Violet 450 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
Sign In for Pricing
View Details AN00429Q-02 100 Tests
Elab Fluor® Violet 450 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
Sign In for Pricing
View Details