Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHBG Peptide - middle region

SHBG Peptide - middle region

Product Specifications

Product Name Alternative

ABP

UniProt

P97497

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEPVMVMTIDLTKISKPHSSFEFRTWDPEGVIFYGDTNTEDDWFLLGLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1B Polyclonal Conjugated Antibody
C27798 100 µL

TCL1B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Amy2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4314307 1.0 µg DNA

Amy2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
HIV1 vif IIIB protein
30-028001 100 ug

HIV1 vif IIIB protein

Sign In for Pricing
View Details
CD200, Rhesus Macaque (HEK293, His)
HY-P76212-01 5 µg

CD200, Rhesus Macaque (HEK293, His)

Sign In for Pricing
View Details
CD200, Rhesus Macaque (HEK293, His)
HY-P76212-02 10 µg

CD200, Rhesus Macaque (HEK293, His)

Sign In for Pricing
View Details
CD200, Rhesus Macaque (HEK293, His)
HY-P76212-03 50 µg

CD200, Rhesus Macaque (HEK293, His)

Sign In for Pricing
View Details