Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI21A6]
TA809419AM 100 µL

UCK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI21A6]

Sign In for Pricing
View Details
AlKyne-PEG-NH2, 10K
HE007005-10K-01 1 g

AlKyne-PEG-NH2, 10K

Sign In for Pricing
View Details
AlKyne-PEG-NH2, 10K
HE007005-10K-02 5 g

AlKyne-PEG-NH2, 10K

Sign In for Pricing
View Details
TBCEL antibody
FNab08521 100 µg

TBCEL antibody

Sign In for Pricing
View Details
Lentiviral mouse Rida shRNA (UAS) - Lentiviral mouse Rida shRNA (UAS, RFP) plasmid
GTR15165949 1 Vial

Lentiviral mouse Rida shRNA (UAS) - Lentiviral mouse Rida shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Tyro3 Antibody
MBS850014-01 0.1 mg

Tyro3 Antibody

Sign In for Pricing
View Details