Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLSTN1 Recombinant Antibody, Cy5.5 Conjugated
bsm-62063R-Cy5.5 100 µL

CLSTN1 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
CR063 Rabbit Polyclonal Antibody
BT-AP08372-01 20 µL

CR063 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CR063 Rabbit Polyclonal Antibody
BT-AP08372-02 50 µL

CR063 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CR063 Rabbit Polyclonal Antibody
BT-AP08372-03 100 µL

CR063 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (HRP)
128123-HRP 100 µL

HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (HRP)

Sign In for Pricing
View Details
Gatsl3 Mouse shRNA Plasmid (Locus ID 71962)
TR504657 1 Kit

Gatsl3 Mouse shRNA Plasmid (Locus ID 71962)

Sign In for Pricing
View Details