Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Lamin B2 Antibody (S02-9I7)
NBP3-15054-25ul 25 µL

Rabbit Monoclonal Lamin B2 Antibody (S02-9I7)

Sign In for Pricing
View Details
REEP6 CRISPRa sgRNA lentivector (set of three targets)(Human)
38790121 3x 1.0µg DNA

REEP6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Protein FAM102B (FAM102B) Human ELISA Kit
G2782 96 Tests

Protein FAM102B (FAM102B) Human ELISA Kit

Sign In for Pricing
View Details
Plcxd3 (NM_177355) Mouse Untagged Clone
MC213069 10 µg

Plcxd3 (NM_177355) Mouse Untagged Clone

Sign In for Pricing
View Details
TWF2 (NM_007284) Human Recombinant Protein
TP301791L 1 mg

TWF2 (NM_007284) Human Recombinant Protein

Sign In for Pricing
View Details
CYP2J5 siRNA (Mouse)
CRM0948-01 15 nmol

CYP2J5 siRNA (Mouse)

Sign In for Pricing
View Details