Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1’-Epi Gemcitabine-13C,15N2 Hydrochloride
011177 1 mg

1’-Epi Gemcitabine-13C,15N2 Hydrochloride

Sign In for Pricing
View Details
N-Ethyl Norlysergic Acid N,N-Diethylamide
TRC-E925270-5MG 5 mg

N-Ethyl Norlysergic Acid N,N-Diethylamide

Sign In for Pricing
View Details
CLK2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV708789 1.0 µg DNA

CLK2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Smgc Rat shRNA Plasmid (Locus ID 446171)
TL700633 1 Kit

Smgc Rat shRNA Plasmid (Locus ID 446171)

Sign In for Pricing
View Details
Ethyl 4[[6- (4-Carbamimidoylphenoxy) hexyl]oxy]benzoate Hydrochloride
449326 25 mg

Ethyl 4[[6- (4-Carbamimidoylphenoxy) hexyl]oxy]benzoate Hydrochloride

Sign In for Pricing
View Details
alpha 1a Adrenergic Receptor (ADRA1A) Human qPCR Template Standard (NM_000680)
HK208370 1 Kit

alpha 1a Adrenergic Receptor (ADRA1A) Human qPCR Template Standard (NM_000680)

Sign In for Pricing
View Details