Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GATA-1 (Rabbit, Polyclonal, IgG)
A100223 100 µL

Anti-GATA-1 (Rabbit, Polyclonal, IgG)

Sign In for Pricing
View Details
RN5S39 Protein Vector (Human) (pPM-C-His)
PV117209 500 ng

RN5S39 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Potassium sorbate, granular, BP, Ph. Eur., USP, FCC grade
GK5815-500g 500 g

Potassium sorbate, granular, BP, Ph. Eur., USP, FCC grade

Sign In for Pricing
View Details
SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (HRP)
S0401-08-HRP 100 µL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (HRP)

Sign In for Pricing
View Details
RIN3 3'UTR GFP Stable Cell Line
TU069929 1.0 mL

RIN3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Uncharacterized protein C08C3.4 (C08C3.4)
MBS1174638-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Uncharacterized protein C08C3.4 (C08C3.4)

Sign In for Pricing
View Details