Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NALP12 Antibody [DyLight 755]
NBP1-76293IR 0.1 mL

Rabbit Polyclonal NALP12 Antibody [DyLight 755]

Sign In for Pricing
View Details
PD-L1 CRISPR/Cas9 KO Plasmid (m)
sc-425636 20 µg

PD-L1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
FA22G rabbit pAb
RA24796-01 50 µL

FA22G rabbit pAb

Sign In for Pricing
View Details
FA22G rabbit pAb
RA24796-02 100 µL

FA22G rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal DHODH Antibody
NBP1-59592 100 µL

Rabbit Polyclonal DHODH Antibody

Sign In for Pricing
View Details
H2AFB1 Antibody
A24269-50UG 50 µg

H2AFB1 Antibody

Sign In for Pricing
View Details