Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Rhesus Macaque (HEK293, His)

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

Molecular Formula

708110 (Gene_ID) H9EXH3 (Q31-G232) (Accession)

Molecular Weight

The protein has a predicted molecular mass of approximately 22.8 kDa. The protein migrates as an approximately 40-49 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Double Stranded DNA Antibody ELISA Kit
MBS047091-01 48 Well

Porcine Double Stranded DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Double Stranded DNA Antibody ELISA Kit
MBS047091-02 96 Well

Porcine Double Stranded DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Double Stranded DNA Antibody ELISA Kit
MBS047091-03 5x 96 Well

Porcine Double Stranded DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Double Stranded DNA Antibody ELISA Kit
MBS047091-04 10x 96 Well

Porcine Double Stranded DNA Antibody ELISA Kit

Sign In for Pricing
View Details
PITPN (PITPNA) (NM_006224) Human Mass Spec Standard
PH308326 10 µg

PITPN (PITPNA) (NM_006224) Human Mass Spec Standard

Sign In for Pricing
View Details
Mouse Monoclonal beta 2-Microglobulin Antibody (4G5A1)
NBP2-37284-0.025mL 0.025 mL

Mouse Monoclonal beta 2-Microglobulin Antibody (4G5A1)

Sign In for Pricing
View Details