Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphopain A (sspP)

This Recombinant Staphylococcus aureus Staphopain A (sspP) spans the amino acid sequence from region 215-388aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Staphopain A (EC 3.4.22.48) (Staphylococcal cysteine proteinase A) (Staphylopain A)

UniProt

P81297

Expression Region

215-388aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yeast yoaJ protein
orb246139-01 20 µg

Yeast yoaJ protein

Sign In for Pricing
View Details
Yeast yoaJ protein
orb246139-02 100 µg

Yeast yoaJ protein

Sign In for Pricing
View Details
Yeast yoaJ protein
orb246139-03 1 mg

Yeast yoaJ protein

Sign In for Pricing
View Details
CPD CRISPR All-in-one AAV vector set (with saCas9)(Human)
16743151 3x 1.0 µg DNA

CPD CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
TMEM62 (NM_024956) Human Tagged Lenti ORF Clone
RC203653L1 10 µg

TMEM62 (NM_024956) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Madoqua guentheri Cytochrome c oxidase subunit 3 (MT-CO3), partial
MBS7056024 Inquire

Recombinant Madoqua guentheri Cytochrome c oxidase subunit 3 (MT-CO3), partial

Sign In for Pricing
View Details