Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast yoaJ protein

This Yeast yoaJ protein spans the amino acid sequence from region 26-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YoaJ

UniProt

O34918

Expression Region

26-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD9 Antibody (HI9a) [PE]
NBP3-18795PE 0.1 mL

Mouse Monoclonal CD9 Antibody (HI9a) [PE]

Sign In for Pricing
View Details
Lgi3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6506407 1.0 µg DNA

Lgi3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Arhgap9 sgRNA CRISPR Lentivector set (Rat)
K7156401 3x 1.0 µg

Arhgap9 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
TUBA1 (Tubulin, alpha 4a, FLJ30169, H2-ALPHA, TUBA1) (MaxLight 490)
253123-ML490 100 µL

TUBA1 (Tubulin, alpha 4a, FLJ30169, H2-ALPHA, TUBA1) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Shewanella loihica ATP synthase subunit c (atpE)
MBS1106082 Inquire

Recombinant Shewanella loihica ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
HIP1 Human Pre-designed siRNA Set A
HY-RS06179 1 Set

HIP1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details