Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast yoaJ protein

This Yeast yoaJ protein spans the amino acid sequence from region 26-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YoaJ

UniProt

O34918

Expression Region

26-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3ORF24 (FANCD2OS) (NM_001164839) Human Recombinant Protein
TP760714 50 µg

C3ORF24 (FANCD2OS) (NM_001164839) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit B/C/D (nuoBCD), partial
MBS1340964 Inquire

Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit B/C/D (nuoBCD), partial

Sign In for Pricing
View Details
IGLL1 Adenovirus (Mouse)
24689054 1.0 mL

IGLL1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Annexin A1 (ANXA1) ELISA Kit
MBS2705616-01 24 Strip Well

Mouse Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Annexin A1 (ANXA1) ELISA Kit
MBS2705616-02 48 Well

Mouse Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Annexin A1 (ANXA1) ELISA Kit
MBS2705616-03 96 Well

Mouse Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details