Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast yoaJ protein

This Yeast yoaJ protein spans the amino acid sequence from region 26-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YoaJ

UniProt

O34918

Expression Region

26-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human CEACAM1 / CD66a (CM-24 Biosimilar)
BIO0133SM-1mg 1 mg

Anti-human CEACAM1 / CD66a (CM-24 Biosimilar)

Sign In for Pricing
View Details
Flg/Bek (phospho Tyr463/466) Rabbit Polyclonal Antibody
E28PP0452 100 µL

Flg/Bek (phospho Tyr463/466) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Golt1a shRNA (UAS) - Lentiviral mouse Golt1a shRNA (UAS, iRFP) (25)
GTR15282938 1 Vial

Lentiviral mouse Golt1a shRNA (UAS) - Lentiviral mouse Golt1a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CYP3A4 enzyme-IN-1
HY-146177 1 Each

CYP3A4 enzyme-IN-1

Sign In for Pricing
View Details
4-Bromo-3-iodobenzoic acid
OR400071-01 1 g

4-Bromo-3-iodobenzoic acid

Sign In for Pricing
View Details
4-Bromo-3-iodobenzoic acid
OR400071-02 5 g

4-Bromo-3-iodobenzoic acid

Sign In for Pricing
View Details