Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Trem2 protein

This Mouse Trem2 protein spans the amino acid sequence from region 19-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Triggering receptor expressed on monocytes 2

UniProt

Q99NH8

Expression Region

19-171aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 20.93kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human T cell receptor alpha variable 34 (TVA34)
orb3004637-01 20 µg

Recombinant Human T cell receptor alpha variable 34 (TVA34)

Sign In for Pricing
View Details
Recombinant Human T cell receptor alpha variable 34 (TVA34)
orb3004637-02 100 µg

Recombinant Human T cell receptor alpha variable 34 (TVA34)

Sign In for Pricing
View Details
Recombinant Human T cell receptor alpha variable 34 (TVA34)
orb3004637-03 1 mg

Recombinant Human T cell receptor alpha variable 34 (TVA34)

Sign In for Pricing
View Details
BMP1 Rabbit Polyclonal Antibody (BF750)
orb2400926 100 µL

BMP1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 750)
MBS6236995-01 0.1 mL

STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 750)

Sign In for Pricing
View Details
STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 750)
MBS6236995-02 5x 0.1 mL

STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 750)

Sign In for Pricing
View Details