Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGR4 Antibody
8G374-AAT 50 µg

LGR4 Antibody

Sign In for Pricing
View Details
P55;50 EBV-Early Antigen (1108-1), CF647 conjugate, 0.1mg/mL
BNC470103-100 1x 100 µL

P55;50 EBV-Early Antigen (1108-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Cervix
CR561343 5 µg

Tissue Total RNA, Cervix

Sign In for Pricing
View Details
TFIP8 Antibody
8C10226-AAT 50 µg

TFIP8 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
BNC680334-100 1x 100 µL

Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ING2 Polyclonal Antibody
E-AB-10397-01 20 µL

ING2 Polyclonal Antibody

Sign In for Pricing
View Details