Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem260 Mouse Gene Knockout Kit (CRISPR)
KN517845 1 Kit

Tmem260 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(1-Piperazinyl)-phenol Dihydrochloride
TRC-P480555-1G 1 g

2-(1-Piperazinyl)-phenol Dihydrochloride

Sign In for Pricing
View Details
2',3'-Isopropylidenecytidine
TRC-I918240-250MG 250 mg

2',3'-Isopropylidenecytidine

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL
BNC680904-500 1x 500 µL

CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YES1 Mouse Monoclonal Antibody [Clone ID: 2F3E6]
AM06215SU-N 100 µL

YES1 Mouse Monoclonal Antibody [Clone ID: 2F3E6]

Sign In for Pricing
View Details
SN-38 Glucuronide
TRC-S589980-5MG 5 mg

SN-38 Glucuronide

Sign In for Pricing
View Details