Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-κB p65 (Ab-468) Antibody
8B7170-AAT 50 µg

NF-κB p65 (Ab-468) Antibody

Sign In for Pricing
View Details
NOXO1 (NM_144603) Human Over-expression Lysate
LY403398 100 µg

NOXO1 (NM_144603) Human Over-expression Lysate

Sign In for Pricing
View Details
SMAP1 (NM_001281440) Human Tagged ORF Clone
RG238340 10 µg

SMAP1 (NM_001281440) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS801481 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
PRAMEF5 (NM_001013407) Human Over-expression Lysate
LC422970 20 µg

PRAMEF5 (NM_001013407) Human Over-expression Lysate

Sign In for Pricing
View Details
Biological Microscope BMIC-301
BMIC-301 1 Unit

Biological Microscope BMIC-301

Sign In for Pricing
View Details