Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctla4. Target Synonyms: Cytotoxic T-lymphocyte-associated antigen 4. Accession Number: P09793. Expression Region: 36~161aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein.

Accession Number

P09793

Expression Region

36~161aa

Host

E. coli

Target

Ctla4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytotoxic T-lymphocyte-associated antigen 4

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUL1 (Y761) polyclonal antibody
BS1081-01 50 µL

CUL1 (Y761) polyclonal antibody

Sign In for Pricing
View Details
CUL1 (Y761) polyclonal antibody
BS1081-02 100 µL

CUL1 (Y761) polyclonal antibody

Sign In for Pricing
View Details
ZP3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
51945126 3x 1.0µg DNA

ZP3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
LRRC15/LIB[Biotin], His & Avi, Cynomolgus/Rhesus macaque
Z04380-100 100 µg

LRRC15/LIB[Biotin], His & Avi, Cynomolgus/Rhesus macaque

Sign In for Pricing
View Details
BBIP1 (BBSome-interacting Protein 1, BBSome-interacting Protein of 10kD, BBIP10, NCRNA00081) (MaxLight 550) discontinued
029425-ML550 100 µL

BBIP1 (BBSome-interacting Protein 1, BBSome-interacting Protein of 10kD, BBIP10, NCRNA00081) (MaxLight 550) discontinued

Sign In for Pricing
View Details
VSIR/VISTA Protein (C-His, Human)
P509606 100 µg

VSIR/VISTA Protein (C-His, Human)

Sign In for Pricing
View Details