Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF19 Rabbit Polyclonal Antibody (HRP)

KIF19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIF19A

UniProt

Q2TAC6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of HUMAN KIF19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Lumican/ LUM Protein, His, E.coli-200ug
QP6324-ec-200ug 200ug

Recombinant Rat Lumican/ LUM Protein, His, E.coli-200ug

Sign In for Pricing
View Details
SUGP2 Rabbit Polyclonal Antibody
orb574446 100 µL

SUGP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH)
orb2936468-01 20 µg

Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH)
orb2936468-02 100 µg

Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Mouse Glucagon Like Peptide 2 ELISA Kit
MBS019927-01 48 Well

Mouse Glucagon Like Peptide 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Glucagon Like Peptide 2 ELISA Kit
MBS019927-02 96 Well

Mouse Glucagon Like Peptide 2 ELISA Kit

Sign In for Pricing
View Details