Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P62480

Expression Region

1-81

Origin

Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Erythrocyte Membrane Protein ELISA Kit
MBS031080 Inquire

Chicken Erythrocyte Membrane Protein ELISA Kit

Sign In for Pricing
View Details
KCNJ15 (NM_002243) Human Tagged ORF Clone
RC203125 10 µg

KCNJ15 (NM_002243) Human Tagged ORF Clone

Sign In for Pricing
View Details
PE-Labeled Human FAP Protein, His Tag (Site-specific conjugation)
FAP-HP245-25tests 25 Tests

PE-Labeled Human FAP Protein, His Tag (Site-specific conjugation)

Sign In for Pricing
View Details
Phospho-ATF2 (Thr69 / Thr51) Polyclonal Antibody, APC Conjugated
bs-12538R-APC 100 µL

Phospho-ATF2 (Thr69 / Thr51) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Estrogen Receptor alpha Rabbit mAb
AB103124 100 µL

Estrogen Receptor alpha Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal VAV2 Antibody
NBP1-86520 0.1 mL

Rabbit Polyclonal VAV2 Antibody

Sign In for Pricing
View Details