Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Oenothera elata subsp. hookeri ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P62480

Expression Region

1-81

Origin

Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1)
MBS6508392-01 0.1 mL

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1)

Sign In for Pricing
View Details
Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1)
MBS6508392-02 5x 0.1 mL

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1)

Sign In for Pricing
View Details
Trichlorfon
558503 50.0mg

Trichlorfon

Sign In for Pricing
View Details
MARCH4 Polyclonal Antibody, Cy5 Conjugated
bs-9338R-Cy5 100 µL

MARCH4 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal MIER2 Antibody (OTI3G7) [Janelia Fluor 549]
NBP2-72683JF549 0.1 mL

Mouse Monoclonal MIER2 Antibody (OTI3G7) [Janelia Fluor 549]

Sign In for Pricing
View Details
CDC25A discontinued
387232-01 20 µL

CDC25A discontinued

Sign In for Pricing
View Details