Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM2 Rabbit Polyclonal Antibody (HRP)

MCM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN

UniProt

P49736

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)
MBS2101950-01 5x 96 Tests

Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)
MBS2101950-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)
MBS2101950-03 10x 96 Tests

Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)
MBS2101950-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Oligophrenin 1 (OPHN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human CYP11B2 protein
orb54634-01 20 µg

Human CYP11B2 protein

Sign In for Pricing
View Details
Human CYP11B2 protein
orb54634-02 100 µg

Human CYP11B2 protein

Sign In for Pricing
View Details