Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYP11B2 protein

This human CYP11B2 protein spans the amino acid sequence from region 25-503aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aldosterone synthase

UniProt

P19099

Expression Region

25-503aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-tagged21-102AA: 25-503AAFull Length : Full length of mature protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin A5 Blocking Peptide
MBS8309013-01 1 mg

Ephrin A5 Blocking Peptide

Sign In for Pricing
View Details
Ephrin A5 Blocking Peptide
MBS8309013-02 5 mg

Ephrin A5 Blocking Peptide

Sign In for Pricing
View Details
Ephrin A5 Blocking Peptide
MBS8309013-03 5x 5 mg

Ephrin A5 Blocking Peptide

Sign In for Pricing
View Details
Uncaria Extract
C02516-5mg 5 mg

Uncaria Extract

Sign In for Pricing
View Details
Anti-Human IL5 Antibody (SAA0373), FITC
FHC13621 100 Tests

Anti-Human IL5 Antibody (SAA0373), FITC

Sign In for Pricing
View Details
GluR8 Antibody
MBS8512088-01 0.05 mg

GluR8 Antibody

Sign In for Pricing
View Details