Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYP11B2 protein

This human CYP11B2 protein spans the amino acid sequence from region 25-503aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aldosterone synthase

UniProt

P19099

Expression Region

25-503aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-tagged21-102AA: 25-503AAFull Length : Full length of mature protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DT series ultrasonic cleaning machine
E1757 1 Unit

DT series ultrasonic cleaning machine

Sign In for Pricing
View Details
BUD31 Rabbit Polyclonal Antibody
orb318934-01 30 µL

BUD31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BUD31 Rabbit Polyclonal Antibody
orb318934-02 50 μL

BUD31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BUD31 Rabbit Polyclonal Antibody
orb318934-03 100 µL

BUD31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BUD31 Rabbit Polyclonal Antibody
orb318934-04 200 µL

BUD31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Whiteness Meter
61-PPT101 1 Unit

Whiteness Meter

Sign In for Pricing
View Details