Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pias2 Rabbit Polyclonal Antibody (FITC)

Pias2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6

UniProt

Q8C5D8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVFSLDGSSSPVEPDLPVAGIHSLPSTSITPHSPSSPVGSVLLQDTKPTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032628

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Glutamate receptor 4 (GRIA4) ELISA Kit
GTR10365687 96 Well

Guinea Pig Glutamate receptor 4 (GRIA4) ELISA Kit

Sign In for Pricing
View Details
BCKDK Rabbit mAb
MBS4753197-01 0.1 mL

BCKDK Rabbit mAb

Sign In for Pricing
View Details
BCKDK Rabbit mAb
MBS4753197-02 5x 0.1 mL

BCKDK Rabbit mAb

Sign In for Pricing
View Details
CobB Antibody
orb823121 2 mg

CobB Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)
orb2919244-01 20 µg

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)
orb2919244-02 100 µg

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

Sign In for Pricing
View Details