Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

A5IUI3

Expression Region

1-187

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF276 (NM_001113525) Human Over-expression Lysate
LC426428 20 µg

ZNF276 (NM_001113525) Human Over-expression Lysate

Sign In for Pricing
View Details
DNMT1 Recombinant Protein
OPCD02777-50UG 50 µg

DNMT1 Recombinant Protein

Sign In for Pricing
View Details
PGAM2 Human, Active
OM298706-01 10 µg

PGAM2 Human, Active

Sign In for Pricing
View Details
PGAM2 Human, Active
OM298706-02 2 µg

PGAM2 Human, Active

Sign In for Pricing
View Details
PGAM2 Human, Active
OM298706-03 1 mg

PGAM2 Human, Active

Sign In for Pricing
View Details
Lyophilized exosomes from LB-B7 cell line cell culture media
EXA-0822-CY97 5 Vials (> 1x 10^10 PaRoom Temperatureicles/Vial)

Lyophilized exosomes from LB-B7 cell line cell culture media

Sign In for Pricing
View Details