Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-187.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

A5IUI3

Expression Region

1-187

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED13L Protein Vector (Human) (pPM-C-His)
PV093701 500 ng

MED13L Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
LMOD3 3'UTR Luciferase Stable Cell Line
TU012540 1.0 mL

LMOD3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EIF3LP2 AAV siRNA Pooled Vector
19128161 1.0 µg

EIF3LP2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CITED2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
16207151 3x 1.0 µg DNA

CITED2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Spib Mouse Pre-designed siRNA Set A
HY-RS22331 1 Set

Spib Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
OACA12520-50UL
OACA12520-50UL 50 µL

OACA12520-50UL

Sign In for Pricing
View Details