Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Rabbit Polyclonal Antibody (Biotin)

MED6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARC33, NY-REN-28

UniProt

O75586

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MED6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE28, CT (ZFYVE28, KIAA1643, LST2, Lateral signaling target protein 2 homolog, Zinc finger FYVE domain-containing protein 28) (APC)
MBS6365294-01 0.2 mL

ZFYVE28, CT (ZFYVE28, KIAA1643, LST2, Lateral signaling target protein 2 homolog, Zinc finger FYVE domain-containing protein 28) (APC)

Sign In for Pricing
View Details
ZFYVE28, CT (ZFYVE28, KIAA1643, LST2, Lateral signaling target protein 2 homolog, Zinc finger FYVE domain-containing protein 28) (APC)
MBS6365294-02 5x 0.2 mL

ZFYVE28, CT (ZFYVE28, KIAA1643, LST2, Lateral signaling target protein 2 homolog, Zinc finger FYVE domain-containing protein 28) (APC)

Sign In for Pricing
View Details
SLC24A4 (Sodium/potassium/Calcium Exchanger 4, Na (+) /K (+) /Ca (2+) -Exchange Protein 4, Solute carrier Family 24 Member 4, SLC24A4, NCKX4) (APC) discontinued
302749-APC 100 µL

SLC24A4 (Sodium/potassium/Calcium Exchanger 4, Na (+) /K (+) /Ca (2+) -Exchange Protein 4, Solute carrier Family 24 Member 4, SLC24A4, NCKX4) (APC) discontinued

Sign In for Pricing
View Details
Human CD40 protein
orb594872-01 10 µg

Human CD40 protein

Sign In for Pricing
View Details
Human CD40 protein
orb594872-02 50 µg

Human CD40 protein

Sign In for Pricing
View Details
Human CD40 protein
orb594872-03 500 µg

Human CD40 protein

Sign In for Pricing
View Details