What is the catalog number for Human CD40 protein?

The catalog number for Human CD40 protein is orb594872.

What sizes are available for Human CD40 protein?

Human CD40 protein is available in the following size(s): 10 µg, 50 µg, 500 µg, 1 mg.

How many pack sizes does Human CD40 protein come in?

Human CD40 protein is available in 4 different pack sizes.

Is Human CD40 protein in stock?

Human CD40 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CD40 protein

This Human CD40 protein spans the amino acid sequence from region 21-193aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5

UniProt

P25942

Expression Region

21-193aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD40L-His-Flag at 10μg/ml can bind Human CD40-Fc, the ED50 of Human CD40-Fc is 0.45 ug/ml.

Form

Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR