Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD40 protein

This Human CD40 protein spans the amino acid sequence from region 21-193aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5

UniProt

P25942

Expression Region

21-193aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD40L-His-Flag at 10μg/ml can bind Human CD40-Fc, the ED50 of Human CD40-Fc is 0.45 ug/ml.

Form

Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN4 Recombinant Monoclonal Antibody
CSB-RA103439A0HU-01 50 μL

ACTN4 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
ACTN4 Recombinant Monoclonal Antibody
CSB-RA103439A0HU-02 100 µL

ACTN4 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
FUS1 Antibody
orb846199 2 mg

FUS1 Antibody

Sign In for Pricing
View Details
Lentiviral human WT1 shRNA (UAS) - Lentiviral human WT1 shRNA (UAS, GFP) plasmid
GTR15346189 1 Vial

Lentiviral human WT1 shRNA (UAS) - Lentiviral human WT1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SPART Rabbit Polyclonal Antibody
TA333849 100 µL

SPART Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CtIP Polyclonal Antibody
E44H04435 100 µL

CtIP Polyclonal Antibody

Sign In for Pricing
View Details