Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea2 Rabbit Polyclonal Antibody (HRP)

Tcea2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SII, S-II, Tcea, Tceat, SII-T1, S-II-T1, AI326274

UniProt

Q9QVN7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Tcea2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein
RPC29165-01 Inquire

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein

Sign In for Pricing
View Details
Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein
RPC29165-02 1 mg

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa mnmE Protein (aa 1-455)
VAng-Cr0829-50gEcoli 50 µg (E. coli)

Recombinant Pseudomonas Aeruginosa mnmE Protein (aa 1-455)

Sign In for Pricing
View Details
MTMR9 siRNA Oligos set (Human)
30915171 3x 5 nmol

MTMR9 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 4 (FGF4) ELISA Kit
MBS262344-01 48 Well

Mouse Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 4 (FGF4) ELISA Kit
MBS262344-02 96 Well

Mouse Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details