Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 17 (FGF17) . Accession Number: O60258; FGF17. Expression Region: 23-216aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 22.64kda. Target Synonyms: Fibroblast Growth Factor 17; FGF-17; FGF17 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein is a purified Active Recombinant Protein.

Accession Number

O60258; FGF17

Expression Region

23-216aa

Host

Mammalian Cells

Target

Fibroblast growth factor 17 (FGF17)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.64kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 17; FGF-17; FGF17

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cog2 Pre-designed siRNA Set A
SI102860A 1 Each

Mouse Cog2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pyrazinamide
S1762-10mM/1mL 10 mM/1mL

Pyrazinamide

Sign In for Pricing
View Details
Kylt® Infl. A FLI-B672
31068 100 Reactions

Kylt® Infl. A FLI-B672

Sign In for Pricing
View Details
PathScan® RP Cleaved Gasdermin D (Asp275) Chemiluminescent Sandwich ELISA Kit
CST 65990C 1 Kit

PathScan® RP Cleaved Gasdermin D (Asp275) Chemiluminescent Sandwich ELISA Kit

Sign In for Pricing
View Details
CAPG Rabbit Polyclonal Antibody
orb511629 100 µg

CAPG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hnf1b Rat siRNA Oligo Duplex (Locus ID 25640)
SR502543 1 Kit

Hnf1b Rat siRNA Oligo Duplex (Locus ID 25640)

Sign In for Pricing
View Details