Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 17 (FGF17) . Accession Number: O60258; FGF17. Expression Region: 23-216aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 22.64kda. Target Synonyms: Fibroblast Growth Factor 17; FGF-17; FGF17 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein is a purified Active Recombinant Protein.

Accession Number

O60258; FGF17

Expression Region

23-216aa

Host

Mammalian Cells

Target

Fibroblast growth factor 17 (FGF17)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.64kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 17; FGF-17; FGF17

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human POLR3E shRNA (UAS) - Lentiviral human POLR3E shRNA (UAS, GFP) plasmid
GTR15312505 1 Vial

Lentiviral human POLR3E shRNA (UAS) - Lentiviral human POLR3E shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human ribosome-inactivating proteins (RIPs) ELISA Kit
201-12-0373 96 Tests

Human ribosome-inactivating proteins (RIPs) ELISA Kit

Sign In for Pricing
View Details
PTS Rabbit pAb
E45R26411N-100 100 µL

PTS Rabbit pAb

Sign In for Pricing
View Details
anti-GTP cyclohydrolase 1
YF-PA11980 50 ug

anti-GTP cyclohydrolase 1

Sign In for Pricing
View Details
CPA2 Polyclonal Antibody
A58646-020 20 µL

CPA2 Polyclonal Antibody

Sign In for Pricing
View Details
SCO2
pro-054 2µg

SCO2

Sign In for Pricing
View Details