Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF791 Rabbit Polyclonal Antibody (FITC)

ZNF791 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ90396, MGC126179, MGC126180

UniProt

Q3KP31

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF791

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETFKNLASIGEKWEDPNVEDQHKNQGRNLRSHTGERLCEGKEGSQCAENF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_699189

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP)
orb2907595-01 20 µg

Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP)
orb2907595-02 100 µg

Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details
Cit 3'UTR GFP Stable Cell Line
TU252375 1.0 mL

Cit 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Calibration Weight , 200g, OIML Class F1
GB-F1-200G 1 Each

Calibration Weight , 200g, OIML Class F1

Sign In for Pricing
View Details
Blue Lo-tox Total Immersion Organic Filled Thermometer -35 to 50C
THE5254 1 Each

Blue Lo-tox Total Immersion Organic Filled Thermometer -35 to 50C

Sign In for Pricing
View Details
TXNL2 (GLRX3) Human Over-expression Lysate
orb1357304 100 µg

TXNL2 (GLRX3) Human Over-expression Lysate

Sign In for Pricing
View Details