Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP)

This Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B2U1G1

Expression Region

1-273

Origin

Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.),  20nm
GAF-444-20 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.), 20nm

Sign In for Pricing
View Details
C2orf3 (GCFC2) (NM_003203) Human Recombinant Protein
TP309540L 1 mg

C2orf3 (GCFC2) (NM_003203) Human Recombinant Protein

Sign In for Pricing
View Details
Human LXN activation kit by CRISPRa
GA111275 1 Kit

Human LXN activation kit by CRISPRa

Sign In for Pricing
View Details
YB1 (YBX1) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF806165 100 µg

YB1 (YBX1) Mouse Monoclonal Antibody [Clone ID: OTI2C9]

Sign In for Pricing
View Details
GPR128 (ADGRG7) (NM_032787) Human Over-expression Lysate
LY403202 100 µg

GPR128 (ADGRG7) (NM_032787) Human Over-expression Lysate

Sign In for Pricing
View Details
Pentacosanoic Acid
TRC-P238193-50MG 50 mg

Pentacosanoic Acid

Sign In for Pricing
View Details